PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C017069P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SBP
Protein Properties Length: 1027aa    MW: 114109 Da    PI: 8.5323
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C017069P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.55.3e-40109186178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqv++C++dls+ak+yhrrhkvCe hsk++++lv +++qrfCqqCsrfh lsefD++krsCrrrLa+hn rrrk+q+
  MELO3C017069P1 109 MCQVDNCKEDLSNAKDYHRRHKVCELHSKSSKALVVKQMQRFCQQCSRFHPLSEFDDGKRSCRRRLAGHNWRRRKTQP 186
                     6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.4E-32106171IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.128107184IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.4E-36108188IPR004333Transcription factor, SBP-box
PfamPF031105.9E-29110183IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1027 aa     Download sequence    Send to blast
MDDLGAQVVP PIFIHQSLTS RYSDLPSIPK KRPLSYHQGQ LHPHTWNPKA WDWDSSKFLT  60
KPSNLNNTTP DDHDDTLRLN LGGRYVEDPV SKPPKKVRPG SPASVTYPMC QVDNCKEDLS  120
NAKDYHRRHK VCELHSKSSK ALVVKQMQRF CQQCSRFHPL SEFDDGKRSC RRRLAGHNWR  180
RRKTQPEDVT SRLTRPGSRG PPSTGNLDIV SLLTVLARAQ GKNEDQSVKS LLSANSDQLI  240
QILNKINSLP LPADLAAKLP NLENFKGKAP PQSSLQHQNK LNGNPSSPST MDLLTVLSAT  300
LAASAPDALA MLSQKSSVSS DSEKTRSSCP SGSDLQNRPL ELPSVGGERS STSYQSPMED  360
SDGQVQGTRV GLPLQLFGSS PEHDAPPNLT ASRKYFSSDS SNPIEERSPS SSPPLLQTLF  420
PVQSTEETTS NGKMPIRKEV NGVEVRKPPS SNIPFELFRE LDGARPNSFQ TIPYQAGYTS  480
SGSDHSPSSL NSDAQDRTGR ISFKLFDKDP SQFPGTLRTQ IYNWLSNCPS EMESYIRPGC  540
VVLSVYMSMS SIAWEQLEEN LVLHLKSLVH SEELDFWRSG RFLVYTGRQL ASHKDGKIHL  600
NKSSKAWSNP ELTLVSPLAV VSGQKTSFLL RGRNLKIPGT RIHCTSMGGY ISEEVMGLSS  660
HGIYDEIHSR SFKVGDVSPT TLGRCFIEVE NGFRGNSFPV IIADATICRE LRHLESDFDE  720
FKVPDISSES SSYVSSQPRL RDEILQFLNE LGWLFQRERS SYELDNPDFL IRRFRFLLTF  780
SAERDFCALV KTLLDILAKK CLITDGLSMK SLEMISEIQL LNRSVKRRCR RMVDLLVHYH  840
VSGFGDAEKK YLFPPNFIGP GGITPLHLAA SMADADDLVD ALTNDPLEIG LECWSSQLDE  900
SGRSPQAYAL MRGNHTCNEL VKRKLGDKKN GQVSVRIGNE IEQLEVSSGE RGRVKGRSCS  960
RCAVVAARCN RRVPGSGTHR LLHRPYIHSM LAIAAVCVCV CLFLRGSPDI GLVAPFKWEN  1020
LGYGTI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-30100183184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818610.0LN681861.1 Cucumis melo genomic scaffold, anchoredscaffold00029.
GenBankLN7132610.0LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008453037.10.0PREDICTED: squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A0A0L4Q10.0A0A0A0L4Q1_CUCSA; Uncharacterized protein
STRINGVIT_18s0122g00380.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14